MSCFo, ( WmConsoleMicrosoft 4e WMCONS~1.000H4,e rconsole.003I4+d WMCONS~1.002I4}e WMCONS~1.001]4e _setup.xmlZ3MSCEc| 0d p |WmConsoleMicrosoft%CE1%\WmConsole%CE2%DriversBuiltIn rconsolewmconsole.exepasswdrconsole.dll defaultDllrconsole.dll PrefixRCX Keep Flags Order MZ@ !L!This program cannot be run in DOS mode. $ѵѵѵҵѵ̵^еѵӵsҵs‘еs֑еsԑеRichѵPED! ""@ SS(p`@`x.text$!" `.rdata/@&@@.data`<@.pdatapB@@.CRTD@@.relocxF@B -P-M20 2D222S 2S D2@4 \0202@@@"$2 000000 S 01010_WA/  2S |$$2S T!00 L((2S (!00!d00!d000@4 00,20,200dS002f? 002 02h 00 T0@4 @t042042 V2 02ߍeTAx`d@@d@p@X@de @d -P-M1@4 $L0000N00S 00C -0080S |0@4 p,000000D0@4 ,0000000Ѝ Bx`AedA -P-M000000 S00000S 0000S 0 S00040 0S0000Ѝd -P- M0 000 000"0S00S 00[00W00 000 0000 Ѝ -P-M 08000S0058 z 000( 000u0  0 00000S 0 v0 00000S 00 0 00Ѝ -P-0S 00]00Y0*Q -P-M00C00@4 000000S0 S d0@4 P0 00 000$ 00ЍehBx`@B -P-M00000S500000 000 000S 00A0T00004000 000 00Ѝd -P-M0S00000 C0 0000S0P000Ѝ -P-0000 -P-M 0S00 0 0 00 0 0 00Y 00U 0s00Ѝ -P- M(00C0$1@4 00, ([0 00 0]00000SP00r0S?00 0S`300L.@0@4 ($000000 ЍBx`edB -P-M 0000 000S00, 0 000 0000 000000 0000 0 0 00Ѝd -P-M000 0 000000Ѝ -P-M000@4 x0000XH<0@4 (0 00 000Ѝ@Cx`eC -P- M0S$00000S~000@0000 0S 00Xq Ѝd -P- M(00 1@4  00, (M0 00 00300C0 000300C000S 0,P0,0,0SWE000 ,0000@0@4  (000000 ЍCx`dC -P-M0 00 0R0$ 0(0 0R0 00 000w000 0S 00h00( 0$0 00B0 0 B0S 00B00( 000 0 B0S0( 000 00B0 0040000 0000$0 0 0$0 000 0 000 00 0(0 0R00 0000f0$ 0(0 0R00u0w00Ѝ -P- M(00 1@4  00, (`0 00 00300C0 000300C000S 0,c0,0,0SWX000 ,0000@0@4  (*000000 Ѝ Dx`C -P-M000 0R{0$00S0 00 000p000 0S 00a00$000 0 B0S 00B00( 0,0 0 B0S0( 0,0 00B0 040,000 0000$0 0 B0$0 0,0 0 0,0 0, 0(0 0R0, 00000$00S00000Ѝ -P-TM\002@4  t0 0p00l00h00d0` \u0<00<0`0@0@ w80R @ w80R @ X2R d00000S$_00 Sy0300C0 0D00300C0D0D0S hdWHH0d0d0SH h0SE5LL0 0d00000\100L)00S 0 0 0 0 000S 00 0R0 000 000 00000$000 000 $00x 0P0 =T LD0P0?W0800808TЍDx`Ded8D -P-M000000 S/000k 000S 000t00q000 0 0R 0(000 0RЍd -P-MH0@4 0 (|000000Ѝ Ex`MB00Ѝ -P-0 00 0 -P-M00 0R000000Ѝ -P-M00 0R 00000000Ѝ -P-M00 0R 00000000Ѝ -P-M.00Ѝ -P- 0 -P- 0 0 00 0 0 00 -P-M0000000 0 0 00xЍ -P-M00Ѝ@ P Ȱ- M( Ѝddd0@-??? @3338888889P:T:==h=l=(?,???????????0<0 00$000<0H0T0`0l0x00000000000011 1`444pp0000 0(00080@0H0P0X0`0h0p0x000000000000000001111 1(10181@1H1P1X1`1h1p1x1111 0wmconsole:server MZ@ !L!This program cannot be run in DOS mode. $ץNFFFɓDɓDFDcpEVAF:apiapGRichFPE}D N:X` P`.textMN `.rdataF/`0R@@.dataD@.pdata@@ -P-XM00p 00d0(PPP0H0H0S0L0C( HPH0 p00 H0 H0 00H0 00H0 d00d `H0$Pl0H0$ h00d0(00C0H00<  P<0 00D00 0  OTT0sHP0L0HP0L0LXЍ -P-M00p000( HP0L00H0(00H00<  P<0 00D00 0  Oxx0s0|00|0pO|0t0tЍ  -P-XML1040  O@@0,0,0s4O080?( SP 00l0Sl0D00D0D0$0(000( ,OHH0S0 ,OLL0Sp00$00h d`/PP0S,kOTT0S ,bO4~O0804yO,0808XЍ  -P-M03042x200S #t2?G<<2S 0 t(@@2S4PO0824KO082x20t2?jHDD200S!x200L"tGHH2S 0 t(LL2S4!O082t4O082oIPP2S!0!tGTT2S 0 tX(XX2S4N082MO4N082F0!0!tG\\2S 0 t3(``2S4N082(jO4N082!t2?aOxFdt2/d20WO0 t(hh2S4N0824N0828ߍx`X`D`0``  -P-HM0 00000T000S T000S#P0?G0S 0 P'0S0000T0000-S T0000+S #P0?F 0S 0 P'$$0S0000T0000000000S 00(0(0hS (0sS (0wS 00 0 00 0000T00P0?G,,000S N00000sNT000!PF440S 0 PQ'880S00I00FT0000-S  0 000 000 0000 000yN<<0SgNT000 PWL@@0S0000RN0 P 'DD0S0000HЍ```|` -P-M60D2200S 200S&2?!FTT2S 0 &XX2SDwM0H2DrM0H2|202?6G\\200S!200%E``2S 0 &dd2SDHM0H2RDCM0H2M202?Ghh200S#M200%Ell2S 0 u&pp2SDM0H2!DM0H2Ftt2S%MM200X$Exx2S 0 H&||2SDL0H2DL0H20 F2S=0%mMkM200#aE2S 0 &2SDL0H2DL0H2\^M200S 0 D2 06M 00FM2S+M)M200x"K2SDL0H2D{L0H2 2SMM2000200!J2SDYL0H2cDTL 0H2^E9F2S0 \L200S 0 (hD2 0L 00 L2SLL2000200 J2SDL0H2D L 0H2LL0 W%2SDK0H2DK0H2Hߍaaala`aLa4a a a`  -P-$M |L,0000040 04L0000$0 4dH 00$Ѝh" -P-M@10<2d200 00h2 00CDD200S<K0@21l20 EHH2SDLLL2S 0P20P2P2000 h.LTT2S 0X20X2X20L<sK0@2@ߍ`  -P-PM00\000S, \00X0?(E44000S L880$0$0S $0C0000\S $00 \00$000 000 K<<0SK X0?C@@0S 0 Xp$DD0S0(0#0(0 K00000l XCHH0S 0 XN$LL0S0(00(0(PЍba -P- Ml 0?wC0S 0 +$0S0000 Ѝ00  G$$0000000S I?((0 0 0 <>,,00 F0SF00F0 <000S00004ЍdxHx8x -P-KM20d40$2400S 40>||4$2 E400s$Ft"4?D4SdE0h4dE0h4/#F?02#E4Sa ?,28"F4(2(2S A/(F4S0,2(F$2S $@4S $,@4S/ ,>400 0L20D20H2082!@>4 240E400040 0000,00(00 0 =4SEDPD0T4ED4SDPD0T4TIލxxxhx  -P-PM9 0 rE00000SH"X0?\=0 X0$0}00 E440S!X0?``0SB000D$ :dd0S 0 hh0S0400400000000 Bll000sA000|#9pp0S 0 tt0S0400400 ~xx0S 0 (||0SA BA040 0S AAAA0400,0,000,,0008 ,0004 ,000 0A0$000000 0 (x0SAAmA040d 0SeA0S0000 A0S 0 0R 00NA$ 000$0kA0S!A@A000 690S 0 0S040 040$ 0R yAA040A0 0S0400404Ѝ@{({{{zz -P- M0?0l 80S 0 0S0000 ЍT{ -P-LMX000S"T0?80S 0 Ty 0S0000X00T0%>9$$0 0 0SX000"T8((0S 0 TN,,0S00d00a 000S }@X000`!Ts8440S 0 T'880S00=00: ]@s<<00f0S00+ 8@@00G@0S000t T98DD0S 0 THH0S00&@00LЍ{{l{X{ -P-8MD000ST"@0? 8 0S 0 @0S00x00uD00@0%>8000SD000!@70S 0 @0S00M00J@ 0S&$$0S0 @7((0S 0 @m,,0S00$?00@@0%>?h70@0%.000?0 @J440S00008Ѝ{{{{ -P-pM00 x?x0000000000|000S 0|00?000S000|000S 00|000S 00|000S#x0?.7440S 0 x880S0(00(0x00|00q?<<0S00A400|00a?@@0S00100|00Q?DD0S00!00|000"x6HH0S 0 xLL0S0(00(00|00x0%>7PP0 0 0S 0|000!x6TT0S 0 x_XX0S0(0V0(0S$ 00|00\\0 0 0S >|0 00!x{6``0S 0 x/dd0S0(0&0(0#0S$00C$000t0  hh00 U> S>0 x ll0S0(00(0(pЍ[D|0||| ||{{ -P-4M<000 0D0?0s00iD0?0S"000S@0S 0 0v>0SD @0L 0 0 00A000S009@$$0S00/000S 000 <((0S000S000 <,,0S D @0 000 0 004Ѝ -P-M$  0008 500=00Ѝ{ -P- Mp 0?50S 0 G0S00:00 Ѝ`| -P-Md60<20020 2 20 2 0200S  020=HH2S02002 0200S 20200S%2?85LL2S 0 PP2S<<0@2=<<0@28 0202%>J6TT2$2$2S$ 0200$5XX2S 0 \\2S<Y<0@2<T<0@2 20202?6``2,2,2S'$< 20200#4dd2S 0 ~hh2S< <0@2<<0@2$ll2S(,<$< 0200#4pp2S 0 Ntt2S<;0@2<;0@2,<xx222S)$w<,u< 20200,"g4||2S 0 2S<;0@2l<;0@2g< 2s $l2(2$2(2(2S ;<242282?0(10"$2(2<$#<(2S",<,y< 2?42S 0 2S<k;0@2<f;(2@2,;0 2S<T;0@2<O;(2@2@ߍ@}f4}}}|||||  -P-M% 000S00 4000S;00 ( )<;;00Ѝ| -P-4M<: 0S004<]$$000S  ((000S ,,000S;00 000000 8 30000p;n;|004Ѝt| -P-M  000S00 300N;  ;H;00Ѝ| -P-M00$0?0s00 0000 0000Ѝ -P-M% 000S00 b3000S;00 ( q;::00Ѝ| -P-,M40S00"4] 000S $$000S00  00c2((00:00,Ѝ| -P-8MD000S D000S!@0?20S 0 @_0S00\00YD00@0%>3 000SD0000!@2$$0S 0 @4((0S00100. D00{2,,0 0 0S^:00@00t0 0000 O:M:0 @440S00008Ѝkp}\} -P-M 00($J0008 #200:0 0 ЍX} -P-cM90\505<600S)86?25S 0 85S\Y90`50\T90`5+<6086?35(5(5S!<600(815S 0 85S\*90`5\%90`5@((:555S#(9<600(815S 0 8[5S\80`5\80`5(9%:5S X95S 9(555sk5;S9555s 5 S 5sXV5[SV<00 5S5]S ]\ U15T5T5S T5P5P5ST09GFT,95S 9,  P5$5P9$5S90%8 75S\p80`5G\k80`5B5"S<00$%m5SI5"SB5=S;555s5"S%;0> xF5S"5"S 0 195 05 051k50 5S5:S S85S0 1XS85S0 1,S85S0 1 S86S0 1 1S;0>"6Sg8611S !l8  6S gf05Q 611SYX Q06X55010 1 X86 5b86,5X'8%8 5S 85S ~800p1,%85  6S\r70`5I\m70`5Dj85S _80 8$$6S\U70`5,\P70`5'N85S C8<600| 8/((6S 0 8,,6S\,70`5\'70`5`cލ~~~}~~~|~x~t~p~l~}P~L~D~8~ ~~~}  -P-M8000s 0S 8 0S00Ѝ -P-M0000000 00R& 7 000s$0S $70S (0S (70S0A, 00 00R00 , 0 000s 700Ѝ -P-8M 9700000 0 0R 0<07 000S700U00 0S T@g$$000,S 700B@Y((000\S@P,,000s 0 S'0.88200S,60026<<2 0 0S 0C0000\S 0C00 00|20x2%>/@@200S!|200h"xk.DD2S 0 xHH2S,5002{,5002v>LL2S#J6|200!x@.PP2S 0 xTT2S,5002P,5002K2s( >XX2(2(2!x.\\20(660S0`2 0 xdd2`2,e5`202x20|0 ihh2050 xll2S,I5002,D50020'ލ|~~  -P-M 00(0008 -0050 0 Ѝ~ -P-0M<000SX"80?- 0S 0 8Z0S00z00w000000<000SY 0<0080?.000S 0<000X!8g-0S 0 80S00;008`5 0W55$$0SC50<000 803((0S00 00+50 8 ,,0S00000Ѝ<( -P-0M<000S$"80?-0S 0 8 0S00m00j<0080?.000S<000t!8,0S 0 8 0S00B00?4 04D5 0S4<000 8,$$0S 0 8^ ((0S000040 8K ,,0S00000Ѝp\ -P-|M000S#0?n,DD0S 0 " HH0S0,00,0000%>-LL0$0$0S $PP000S$C4000"9,TT0S 0  XX0S0,00,0 00000$_\\0S$4000! ,``0S 0  dd0S0,0a0,0^ 00(0 00000000 v4hh00G4$30S 000!1ll0S0,050,02(-4 0S 000 +pp0S 0 q tt0S0,00,00 ` xx0S0,00,0,|Ѝ -P-(M4000S!00?+0S 0 05 0S00Z00W40000?,000S4000(!0V+0S 0 0 0S00/00,.0S:34000 0*1 0S0000%30 0 $$0S0000(ЍH4  -P- M0%>0l +0S 0  0S0000 Ѝh -P-@ML000S"H0?*0S 0 H 0S0 00 0L00H0%>+000S / 000S2L000!H* 0S 0 HY $$0S0 0a0 0^ 00000((0S2L0004+000S p 000S1L000!H) 0S 0 H $$0S0 0a0 0^ 00000 ((0S1L000(*XX000S d \\000S0000"(``0S 0  dd0S0(00(0 00000 hh0S00008"(ll0S 0 a pp0S0(0r0(0o 0 0 tt000S!000 00|!(xx0S 0 3 ||0S0(0D0(0A 0000 0 00000$00W0U00S 0 00000000$ $.0S0(00(00 0S0(00(0(Ѝ褁t`D@<8$ -P-/ ,? 0 $,\\2S t3``200S ,,@=,0D2 ,dd2S,,0 thh2S@",0D2@,0D2Dߍ萃|  -P- Ѝ10@4x40!+HH400s!p4?*LL4S@+0D4O@+0D4J+4 ,;400+PP4S5 A/#$, t# 'TT4S\#,XX4<4<4S t<4&\\4S  xp!``400S +@+0D4 +dd4Sw+@+0D4Dˠh Ѝ\  -P-'M,20(2|2$0$2|20 U,TT2 2 2S A/ c,XX2S0$2 7, $c$\\200 0|2000|2000|2000|200P!x#``2S $!x2?#dd2S+(I+0<25+ 2-$hh2000200 0200020002 000200` x#ll2S+(+0<2+(+0<2<'ލ8  -P-$M+000S00B/+0 0 +0/00+0%.000 *0S t+000?0000x l` 0/ 000?0s*Y+00 ,0 00$Ѝ@<8 -P-0?0S 0?%"0?**0%>3+0?/+-+ -P-M(00 0"0?|*0/000?0s000?0O! 0S0?L*0000Ѝ -P-M+)+000000S +0 $$0e0{+Ѝ踃 -P-M 0?0S00  0?! 0/0000Ѝ -P- M, (60S0 0,0S0 0"n0SK0 0l000S0S80 020 0 Ѝ -P-M.00000 0R0 00*0S000 0R 0 00* 0 00ЍH -P- M @* 00D Q000S * 0 &* Ѝ -P-(M1000e?00 0"0S00+00 0 0S 00 0 0 0S 0S 0S 0 000S00 0=$$0 0 00(Ѝ脆h -P-@M0 H000S0,0000(00 00000S (0 0R* 000 0 5*440 0 0S(00C(0(00C(0(0S(0 00) ))0,0 0 000000 S00"S 0000000S 00 S 0 C0R 00C0\S 0000000000S 00"S 0 C0R 00C0\S  00BL)8(0 0 800(0 000S(00C(0(00C(0(0S(0 00") ))0,0M(0 00000$0$ 0R*$00\S$0 0R *$00)<<0S $00$0$0 0 000$00$0 00(00(00000000S 00 S (0 0 00( 0,0,@ЍL -P-M000000 000S 0 00( (Ѝ -P-M000000)S000$0(0S$ 00000 00$00l  w 0S 0  +0S0000ЍPȄ -P-(M0 0U0S0070 00 0E0S >(00%00 0# 0S 0p 0) (( &(00 !( (0 0$$00(ЍĆ -P-M10|0J(0(S |h'00NQ0`0`0S|Z'00@0e.( 0e `"( `h`'000000Sd t00=(0Sh 00 d0S |'00|'00Ѝ  -P-M10 1xpQ(100S &01L (1S> '1110C11S 1 C00'  1S  1 00:'$$100S 00000<'((1S '', &,11' &01ލ贆  -P-,M0008000000@0 0 000@0C4 0 000 0<00@00@0S0$00$0$ 404000((0So&0 0j&0 0 ,Ѝ  -P-(Mh100 0000000SN&00C0 40 000000$00000& 000S1&00&0S  000000$$ 0R &&00 0 00 80  <0  &00(Ѝ  -P- M(00\S(00(0\(;'000S(&0(000 (00B00000000S 000 0('0S0S0 0  0,0000 0 Ѝ؇ -P- M(00\S(00(0\(&000S(D&0(000 (00B00000000S0000 0R 0000(&0S0S0 0  0,00 00 0 Ѝ -P-@M0 0 00000 PL&,,0S 0 0? %00000S0 04 00000 PLr&440S %0 0"0S@ |00 8800 0S04<<0000%0 0 @ЍD -P-MT@&000S 0 0\%0 0 00Ѝ -P-@MH((000S H &,,000S00a H00B00 00000 000S>%00H9% L;%L00000L0  %440S %00/L00'%8L0 800L000S u%00L000L0000L0  %<<0S L00$ \%00 W%00@Ѝ -P-00$ -P-8M@00S@~00m@00S @000d00_@00S @00S@00tS00N@00S.@00004D00$ 0000000S  /$$00$00$((00000@00S@p!,,00@00S@@0000@ 4400>0 0 8ЍpdXH<0  -P-M$r$(00000 0T$000S0 0/$%00V$0000000(00 0R*0S \$000(00 00 ($0000 0 Ѝ -P- M(00S(006(00S (000 00((00S(00}00(00S(p~00(00S(@s00( l0000 Ѝ̈| -P- M00000\S00000000000S10100 01000J$0S0t10000000S 0<10000000\S0S0 0:000000000S000 ,0 !,000 x0@H $0S0000000 0 Ѝ蘇 -P-M  < 000S00 ^00#00Ѝ -P-pMxXX0(0(0S0,0s/|#(0|#x$:\\0S&|0/0000000000|0!> 00000|0?00 $#``0S $5#0,0@$0#;x#dd0 0 0S0,02( x00B0 0 00(00(0 $hh0S "0,0 "|0?000|0? ($U#ll0S $"0,0$"0,0,pЍ -P-2M60T2,"2S0L2L20L2L2S*/(w"L0600 2 0 0S*T!0X2q03S 0L05002S; L0500( #00200000000? 00000?00 LB "2S( <832P2P2S "Ty!P2X2$43S <3083 0 z22022P2 !P2ST]!P2X2w,22STO!0X20L2L20L2/(!A?@20 000$0000 =( LH"2S B( ,tZ2 0 0S*H"T !0X2$00203S 0(H2S! ?000$0 (H["2S( <832P2P2SH! !T P2X2 !0L2L20L2/(!A?@20 0000000 =( LH>"3S u( ,3 0 0S*H!T 0X2j03S 0(3S:   3S300200000000? 00000?00 D!3S( <833P2P2S D~!H|! !T{ P2X2&Ds!43S <3083 0 z33033P2 P2SHZ!T[ P2X2nHR!TS 0X2X2ލ܈  -P- M(0S (,00 ,$00,0?0s0, , !.  h`?00C,0?0S0101,0?0S 10),0?0S00!,0?0S00,0?0S00,0?0S|00 ,0?0SX00H000, / (00s 0 0 Ѝ,($   -P-xM !``000S0400$0dd0Shh0$0$0S@ 040y$ 00$ 00B0000,0$00,0\, ll0$0$0S0 $ ,00B00000, 000 00 00(0 00000000  pp00_ 0S 0400(000S 00(0 00000000 ,l tt00= 0S 040(000S  0 (( 0404xЍ -P- M00(0S-, , 000,00"S,00,000C000"S ,0R*006 ,0A,00 ,00B000 "(0S000S00 , 0 0 00(0S0,0000 Ѝ -P- t000 `000 L000 8000 $000 000 00vT2ܺ#Eg -P-M000;#=000!0 00 00!0S*000 00 00.0 00  00?S0@0c0 000 0@000? 0R* 00000 0 B000Ѝ -P-\Ml<0X00T0@ hTd00@0d000D0d000L0d0 00H0d000P0T00,T00#4 80#T00$T00#< 800 T0 @0-@02L H0 "D0 H0 "T00 `;0 P00P0D0/D0#10D0T000,T000#4 80#T000$T000#< 800 T00 P0-P02T0D L0 "@0 L0 "0 :0 H00H0@0/@0#10@0T000,T000#4 80#T000$T000#< 800 T00 H0-H02T0@ D0 "P0 D0 "0 90 L00L0P0/P0#10P0T0 00,T0 00#4 80#T0 00$T0 00#< 800 T0 0 L0-L02T0 P @0 "H0 @0 "0 80 D00D0H0/H0#10H0T000,T000#4 80#T000$T000#< 800 T00 D0-D02T0H P0 "L0 P0 "0 70 @00@0L0/L0#10L0T000,T000#4 80#T000$T000#< 800 T00 @0-@02T0L H0 "D0 H0 "0 70 P00P0D0/D0#10D0T000,T000#4 80#T000$T000#< 800 T00 P0-P02T0D L0 "@0 L0 "0 60 H00H0@0/@0#10@0T000,T000#4 80#T000$T000#< 800 T00 H0-H02T0@ D0 "P0 D0 "0 @50 L00L0P0/P0#10P0T0 00,T0 00#4 80#T0 00$T0 00#< 800 T0 0 L0-L02T0 P @0 "H0 @0 "0 `40 D00D0H0/H0#10H0T0$00,T0$00#4 80#T0$00$T0$00#< 800 T0$0 D0-D02T0$H P0 "L0 P0 "0 30 @00@0L0/L0#10L0T0(00,T0(00#4 80#T0(00$T0(00#< 800 T0(0 @0-@02T0(L H0 "D0 H0 "0 20 P00P0D0/D0#10D0T0,00,T0,00#4 80#T0,00$T0,00#< 800 T0,0 P0-P02T0,D L0 "@0 L0 "0 10 H00H0@0/@0#10@0T0000,T0000#4 80#T0000$T0000#< 800 T000 H0-H02T00@ D0 "P0 D0 "0 00 L00L0P0/P0#10P0T0400,T0400#4 80#T0400$T0400#< 800 T040 L0-L02T04P @0 "H0 @0 "0 0yZ 0 D00D0H0/H0#10H0T0800,T0800#4 80#T0800$T0800#< 800 T080 D0-D02T08H P0 "L0 P0 "0 d?0 @00@0L0/L0#10L0T0<00,T0<00#4 80#T0<00$T0<00#< 800 T0<0 @0-@02T0<L H0 "D0 H0 "0 >0 P00P0D0/D0#10D0T04 T0 0 0 "T000 "T000"T04 T0 0 0 "T000 "T000"? T0 P0-P02D L0 "@0 L0 "T00 =0 H00H0@0/@0#10@0T08 T0$0 0 "T0 00 "T0000"T08 T0$0 0 "T0 00 "T0000"? T00 H0-H02T0@ D0 "P0 D0 "0 <0 L00L0P0/P0#10P0T0< T0(0 0 "T000 "T0000"T0< T0(0 0 "T000 "T0000"? T00 L0-L02T0P @0 "H0 @0 "0 ;0 D00D0H0/H0#10H0T0,T0 0 "T000 "T0 000"T0,T0 0 "T000 "T0 000"? T0 0 D0-D02T0 H P0 "L0 P0 "0 :0 @00@0L0/L0#10L0T0 T000 0 "T000 "T0000"T0 T000 0 "T000 "T0000"? T00 @0-@02T0D L0 "H0 "0 90 P00P0D0/D0#10D0T0 T040 0 "T000 "T0000"T0 T040 0 "T000 "T0000"? T00 P0-P02T0@ D0 "L0 "0 80 H00H0@0/@0#10@0T0 T080 0 "T0 00 "T0000"T0 T080 0 "T0 00 "T0000"? T00 H0-H02T0P @0 "D0 "0 70 L00L0P0/P0#10P0T0 T0<0 0 "T0$00 "T0000"T0 T0<0 0 "T0$00 "T0000"? T00 L0-L02T0H P0 "@0 "0 60 D00D0H0/H0#10H0T00 T00 "T0(00 "T0 000"T00 T00 "T0(00 "T0 000"? T0 0 D0-D02T0 L H0 "P0 "0 50 @00@0L0/L0#10L0T0 T00 0 "T0,00 "T0$000"T0 T00 0 "T0,00 "T0$000"? T0$0 @0-@02T0$D L0 "H0 "0 40 P00P0D0/D0#10D0T0 T00 0 "T0000 "T0(000"T0 T00 0 "T0000 "T0(000"? T0(0 P0-P02T0(@ D0 "L0 "0 30 H00H0@0/@0#10@0T0 T0 0 0 "T0400 "T0,000"T0 T0 0 0 "T0400 "T0,000"? T0,0 H0-H02T0,P @0 "D0 "0 20 L00L0P0/P0#10P0T0$ T00 0 "T0800 "T00000"T0$ T00 0 "T0800 "T00000"? T000 L0-L02T00H P0 "@0 "0 10 D00D0H0/H0#10H0T0( T00 0 "T0<00 "T04000"T0( T00 0 "T0<00 "T04000"? T040 D0-D02T04L H0 "P0 "0 00 @00@0L0/L0#10L0T0, T00 0 "T00 "T08000"T0, T00 0 "T00 "T08000"? T080 @0-@02T08D L0 "H0 "0 0nyZ0 P00P0D0/D0#10D0T00 T00 0 "T000 "T0<000"T00 T00 0 "T000 "T0<000"? T0<0 P0-P02T0<@ D0 "L0 "0 ?0 H00H0@0/@0#10@0T04 T0 0 0 "T000 "T000"T04 T0 0 0 "T000 "T000"? T0 H0-H02P @0 "D0 "T00 >0 L00L0P0/P0#10P0T08 T0$0 0 "T0 00 "T0000"T08 T0$0 0 "T0 00 "T0000"? T00 L0-L02T0H P0 "@0 "0 =0 D00D0H0/H0#10H0T0< T0(0 0 "T000 "T0000"T0< T0(0 0 "T000 "T0000"? T00 D0-D02T0L H0 "P0 "0 =0 @00@0L0/L0#10L0T0,T0 0 "T000 "T0 000"T0,T0 0 "T000 "T0 000"? T0 0 @0-@02T0 D L0 "H0 "0 <0 P00P0D0/D0#10D0T0 T000 0 "T000 "T0000"T0 T000 0 "T000 "T0000"? T00 P0-P02T0@ D0 "L0 "0 ;0 H00H0@0/@0#10@0T0 T040 0 "T000 "T0000"T0 T040 0 "T000 "T0000"? T00 H0-H02T0P @0 "D0 "0 $:0 L00L0P0/P0#10P0T0 T080 0 "T0 00 "T0000"T0 T080 0 "T0 00 "T0000"? T00 L0-L02T0H P0 "@0 "0 ,90 D00D0H0/H0#10H0T0 T0<0 0 "T0$00 "T0000"T0 T0<0 0 "T0$00 "T0000"? T00 D0-D02T0L H0 "P0 "0 480 @00@0L0/L0#10L0T00 T00 "T0(00 "T0 000"T00 T00 "T0(00 "T0 000"? T0 0 @0-@02T0 D L0D L0 H00 0 070 P00P0D0/D0#10D0T0 T00 0 "T0,00 "T0$000"T0 T00 0 "T0,00 "T0$000"? T0$0 P0-P02T0$@ D0@ D0 L00 0 (60 H00H0@0/@0#10@0T0 T00 0 "T0000 "T0(000"T0 T00 0 "T0000 "T0(000"? T0(0 H0-H02T0(P @0P @0 D00 0 50 L00L0P0/P0#10P0T0 T0 0 0 "T0400 "T0,000"T0 T0 0 0 "T0400 "T0,000"? T0,0 L0-L02T0,H P0H P0 @00 0 40 D00D0H0/H0#10H0T0$ T00 0 "T0800 "T00000"T0$ T00 0 "T0800 "T00000"? T000 D0-D02T00L H0L H0 P00 0 30 @00@0L0/L0#10L0T0( T00 0 "T0<00 "T04000"T0( T00 0 "T0<00 "T04000"? T040 @0-@02T04D L0D L0 H00 0 20 P00P0D0/D0#10D0T0, T00 0 "T00 "T08000"T0, T00 0 "T00 "T08000"? T080 P0-P02T08@ D0@ D0 L00 0 10 H00H0@0/@0#10@0T00 T00 0 "T000 "T0<000"T00 T00 0 "T000 "T0<000"? T0<0 H0-H02T0<P @0P @0 D00 0 0ܼn0 L00L0P0/P0#10P0T04 T0 0 0 "T000 "T000"T04 T0 0 0 "T000 "T000"? T0 L0-L02H P0H P0 @00 T00 $?0 D00D0H0/H0#10H0T08 T0$0 0 "T0 00 "T0000"T08 T0$0 0 "T0 00 "T0000"? T00 D0-D02T0L H0L H0 P00 0 >0 @00@0L0/L0#10L0T0< T0(0 0 "T000 "T0000"T0< T0(0 0 "T000 "T0000"? T00 @0-@02T0D L0D L0 H00 0 =0 P00P0D0/D0#10D0T0,T0 0 "T000 "T0 000"T0,T0 0 "T000 "T0 000"? T0 0 P0-P02T0 @ D0@ D0 L00 0 <0 H00H0@0/@0#10@0T0 T000 0 "T000 "T0000"T0 T000 0 "T000 "T0000"? T00 H0-H02T0P @0P @0 D00 0 ;0 L00L0P0/P0#10P0T0 T040 0 "T000 "T0000"T0 T040 0 "T000 "T0000"? T00 L0-L02T0H P0H P0 @00 0 :0 D00D0H0/H0#10H0T0 T080 0 "T0 00 "T0000"T0 T080 0 "T0 00 "T0000"? T00 D0-D02T0L H0L H0 P00 0 80 @00@0L0/L0#10L0T0 T0<0 0 "T0$00 "T0000"T0 T0<0 0 "T0$00 "T0000"? T00 @0-@02T0D L0D L0 H00 0 70 P00P0D0/D0#10D0T00 T00 "T0(00 "T0 000"T00 T00 "T0(00 "T0 000"? T0 0 P0-P02T0 @ D0@ D0 L00 0 60 H00H0@0/@0#10@0T0 T00 0 "T0,00 "T0$000"T0 T00 0 "T0,00 "T0$000"? T0$0 H0-H02T0$P @0P @0 D00 0 50 L00L0P0/P0#10P0T0 T00 0 "T0000 "T0(000"T0 T00 0 "T0000 "T0(000"? T0(0 L0-L02T0(H P0H P0 @00 0 40 D00D0H0/H0#10H0T0 T0 0 0 "T0400 "T0,000"T0 T0 0 0 "T0400 "T0,000"? T0,0 D0-D02T0,L H0L H0 P00 0 30 @00@0L0/L0#10L0T0$ T00 0 "T0800 "T00000"T0$ T00 0 "T0800 "T00000"? T000 @0-@02T00D L0 "H0 "0 20 P00P0D0/D0#10D0T0( T00 0 "T0<00 "T04000"T0( T00 0 "T0<00 "T04000"? T040 P0-P02T04@ D0 "L0 "0 10 H00H0@0/@0#10@0T0, T00 0 "T00 "T08000"T0, T00 0 "T00 "T08000"? T080 H0-H02T08P @0 "D0 "0 00 L00L0P0/P0#10P0T00 T00 0 "T000 "T0<000"T00 T00 0 "T000 "T0<000"? T0<0 L0-L02T0<H P0 "@0 "0 0bܼ0 D00D0H0/H0#10H0T04 T0 0 0 "T000 "T000"T04 T0 0 0 "T000 "T000"? T0 D0-D02L H0 "P0 "T00 h?0 @00@0L0/L0#10L0T08 T0$0 0 "T0 00 "T0000"T08 T0$0 0 "T0 00 "T0000"? T00 @0-@02T0D L0 "H0 "0 p>0 P00P0D0/D0#10D0T0< T0(0 0 "T000 "T0000"T0< T0(0 0 "T000 "T0000"? T00 P0-P02T0@ D0 "L0 "0 x=0 H00H0@0/@0#10@0T0,T0 0 "T000 "T0 000"T0,T0 0 "T000 "T0 000"? T0 0 H0-H02T0 P @0 "D0 "0 <0 L00L0P0/P0#10P0T0 T000 0 "T000 "T0000"T0 T000 0 "T000 "T0000"? T00 L0-L02T0H P0 "@0 "0 ;0 D00D0H0/H0#10H0T0 T040 0 "T000 "T0000"T0 T040 0 "T000 "T0000"? T00 D0-D02T0L H0 "P0 "0 :0 @00@0L0/L0#10L0T0 T080 0 "T0 00 "T0000"T0 T080 0 "T0 00 "T0000"? T00 @0-@02T0D L0 "H0 "0 90 P00P0D0/D0#10D0T0 T0<0 0 "T0$00 "T0000"T0 T0<0 0 "T0$00 "T0000"? T00 P0-P02T0@ D0 "L0 "0 80 H00H0@0/@0#10@0T00 T00 "T0(00 "T0 000"T00 T00 "T0(00 "T0 000"? T0 0 H0-H02T0 P @0 "D0 "0 70 L00L0P0/P0#10P0T0 T00 0 "T0,00 "T0$000"T0 T00 0 "T0,00 "T0$000"? T0$0 L0-L02T0$H P0 "@0 "0 60 D00D0H0/H0#10H0T0 T00 0 "T0000 "T0(000"T0 T00 0 "T0000 "T0(000"? T0(0 D0-D02T0(L H0 "P0 "0 50 @00@0L0/L0#10L0T0 T0 0 0 "T0400 "T0,000"T0 T0 0 0 "T0400 "T0,000"? T0,0 @0-@02T0,D L0 "H0 "0 40 P00P0D0/D0#10D0T0$ T00 0 "T0800 "T00000"T0$ T00 0 "T0800 "T00000"? T000 P0-P02T00@ D0 "L0 "0 30 H00H0@0/@0#10@0T0( T00 0 "T0<00 "T04000"T0( T00 0 "T0<00 "T04000"? T040 H0-H02T04P @0 "D0 "0 20 L00L0P0/P0#10P0T0, T00 0 "T00 "T08000"T0, T00 0 "T00 "T08000"? T080 L0-L02T08H P0 "@0 "0 10 D00D0H0/H0#10H0T00 T00 0 "T000 "T0<000"T00 T00 0 "T000 "T0<000"? T0<0 D0-D02T0<L H0 "P0 "0 00 @00@0L0/L0#10L0d0 @0 d0 d00 D0 d00 d00 L0 d00 d0 0 H0 d0 0 d00 P0 d00 0P0P0H0H0L0L0D0D0@0X \Ѝb -P-M100000000S*0S:0000$0 000c00320 00 0$$000~? S  $ $000000S*0#0$000c00320 000 0 00@ $0  $  $0   $0$ Ѝ舉  -P-hM000000 S=0T"Lp P 0000000 p XX p0 p00s" w 0 00000000 wp@ \\0S 0S p0 00p0w 0 S080Mp0 00p00sC0! `p0 `00p000S08030000000 p P dd p0 p00sp00 080  p00000 00000000 wp 0808hЍ -P-M 0  0  0  00Ѝ -P-$M0 00000000 w, 0 0 $Ѝ -P-0 0S 00 -P- M$ 000S00$  0 0 P000 <000 000x 0 00 ЍH.- -P-M0000 $0R0$  A  000S 0000 0 Ѝ -P- M(000C 0000000 00R10,0000000 0R0    A 0 0 0S0 00 000 0000 00 Ѝ -P-M 0000S 0 0P0  Ѝ -P-M<0 000S+(000$ A 0 0 0S 0R0000 0S 0D0000 0000Ѝ舑 -P-M<0 0000S+(000$ A 0 0 0S 0R0000 0S 0D0000 0000Ѝ舑 -P-M000q 000000Ѝ -P-M000 000000Ѝ -P-(M< 0 V000S+<0008 A+ 000S 0R00000S  0000 0 0 00S00T 00 40$$0000(Ѝ舑 -P-M 0000  000000Ѝ -P-M 0S# 0 0 $00 0000S0000000 0R  000 00000 0000Ѝ -P-M 0S 0 0 $00000S0000000 0R 0000A 00 0 0000Ѝ -P-@ML00\SLd00]HL0SH$ 00OH$$000S00s\A((000S00 L2,,0S( 00\+00000S 0 00HL00L0L00\SL00L0L00S 008L 44000S) @880 0 0S 0 C000 S 0 C0 00+<<000S 0 C000\S0 C0 0000@Ѝ܉؉ԉЉ̉ȉ -P-M S 000S00  0000Ѝ -P- M000s0000 Ѝ -P-M  000S00 00}00Ѝ -P-Mm000S 000S0 00 0 00Ѝ -P-M$300000 0002x02|0202020202020202020x201S 1(000S00~01b000S  00C0S00010A 00 00S 0S 10x1000 0S T10D100010 101004010S $0S500&2 03020202C0x000h @8108001 00 40000 00ЍlTPL@4(   -P-M\ 000S *0 0S?00S 000000Ѝ -P-(M400S 000S 400*SQ4004040040400*S400S0000000000S. 80S00?8#804098#800 0R00000 0 000 400R00000 0 0S 000S00I3400?S/ 80S008#81408#811 1R000000 000 400R0 00 0 000S004004000000f400 000R0$00$0$00(Ѝ -P-PM#000S00X000S 1 01 0X .$$000S00g((000sM 0S p1,0`1,00( X, 00000Sk0'UU0Bu44 0l00 880 0 <<0S 0@00@0@0 0G 0S~@ 00sDD0Sp2XHH0S 0L00L0L00PЍ蜊| -P-M3000S 0C0000\S0 00 0 00Ѝ -P-LM# 000S00T$$0 0 0S 2(01(0T(v,,000S00h00000sY 0S t140d1400( T4S88000S00C00X0S X0(@<<0S  d`0@@000S\0S 00 d00`0 XDD000S|00 HH0Sn00LЍȊ-M00000 8h0S 000000Ѝ< -P-'M820D2xLL200SD0H2|00 PP2S\BTT200S"D0H2b 00 00B0x200<200<2\<XX200S'  x20B0@2@0x@00 00 ?\\2S ``2SDD0H2 00|2S x"dd2S xhh2S 0l20l2l20D"0H2H'ލ  -P-HM000000000P  000 0 0SP44004 88000S0,0,<<0000C00S 0 C00x@@0S  0 00P <DD00c0S o0,0,HЍԊ -P- M0 000S 0 ,(D00@0S00804 ,(000S000 ,(0000 Ѝ -P-M,00000,0( $ 000000Ѝ -P-M,000400,0 ($000000Ѝ -P- M00<0000C00000S 0"00 0#1 00#000 Ѝ -P-DM0000000 L88000s0$00 00000000 P<<000S 0@00@0@0$0$DЍ -P-M$0000S0 0+00$00S  $0S n0 00 0 000$00$0$00,S$00$0 0 B(0 0 0 Ѝ  -P-M00 000$0 0 (000000 0R *0 00R  00 0 0R (00B00 $0R $0 B00C0$0 000Ѝ -P-M$00 (000,0 0 0000000 0R&*0  0 0R  00 0 0R 000B00 ,0R ,0 B00C0,0 000ЍؑԑБ̑ȑđ弑帑崑少@ P Ȱ- M( Ѝ $d0@- '%s' %s\%sUnable to copy file: '%s' -> '%s' Unable to retrieve directory stats CAVB = %lu bytes TOTB = %lu bytes FREE = %lu bytes Goodbye! %s Missing argouments Invalid path: '%s' Missing argoument Invalid path: '%s' Cannot open: '%s' WmConsole supported commands: pwd = Prints the current directory cd DIR = Change current directory to DIR (.. is allowed) ls [DIR/FILE] = Lists the current directory or the specified path ps = Lists currently running processes lsmod [MATCH] = Lists modules loaded by processes whose name match MATCH wld MATCH = Lists all processes that load modules matching MATCH kill PID = Terminates the process identified by PID run EXE ... = Starts the exe with the specified parameters exec EXE ... = Starts the exe with the specified parameters and links to the process standard output/input. This differs from the 'run' command because it waits for the program termintation df [DIR] = Prints the disk space statistics for DIR (or object store in case DIR is not specified mem = Displays memory usage statistics lssvc = Lists device services svc -{S,T} SVC = Controls services functionality. Supported actions are: S : Start service SVC T : Stop service SVC lsdev = Lists system devices mkdir [-p] DIR = Create directory DIR. Allowed flags for the command are: p : Create all the intermediate directories, if missing rmdir DIR = Remove directory DIR (must be empty) rm FILE = Remove file FILE mv OLD NEW = Renames files or directories from OLD to NEW cp SRC DST = Copy SRC file onto DST file. If SRC is a directory, the whole SRC tree will be copied rmtree DIR = Remove directory DIR and all its subtree (dangerous) chmod MODE FILE = Change the access mode of FILE applying MODE changes ([+-][hws]+ | h=hidden w=write s=system) exit = Exit session shutdown = Exit session and shutdown the WmConsole server reboot = Exit session and reboot the device cat FILE = Dump the content of remote file FILE on screen find [-1s] PATH MATCH = Recursively searches PATH for MATCH file or directory name (wildcards allowed in MATCH). Allowed flags for the command are: 1 : Do not recurse inside subdirectories s : Print only the file path put [-Rf] REM LOC = Copies the local file(s) LOC to the remote file/path (on device) REM. Wildcards allowed in LOC. Allowed flags for the command are: R : Recurse to subdirectories f : Forces the missing subdirectories creation on the device get [-R] REM LOC = Copies the remote file(s) (on device) REM to local file/path LOC. Wildcards allowed in REM. Allowed flags for the command are: R : Recurse to subdirectories rpwd = Prints the current registry key rcd KEY = Change current registry key to KEY (.. is allowed) rls [KEY/RVAL] = Lists the current registry key or the specified KEY rcat RVAL = Dump the content of registry path RVAL on screen rfind KEY MATCH = Recursively searches KEY path for MATCH value or key name rrm RVAL = Remove the registry value RVAL rrmtree KEY = Remove the registry key KEY and all its subtree (dangerous) rmkkey KEY = Creates the registry key KEY rset RVAL TYPE VALUE = Sets the registry value RVAL to VALUE, with data type TYPE. Allowed data types for the command are: SZ : String value DW : DWord value BI : Binary value (VALUE is a sequence of 2 hexdigit numbers, comma separated, like: 03,c2,fa,...) rdig [-i] KEY TYPE DATA = Recursively searches the KEY registry path for DATA bytes. Allowed data types for the command are: SZ : String value DW : DWord value BI : Binary value (VALUE is a sequence of 2 hexdigit numbers, comma separated, like: 03,c2,fa,...) The DATA parameter format depends on the TYPE. Allowed flags for the command are: i : Ignore case during string match rexp [-R] KEY/RVAL FILE = Exports the registry value RVAL or key KEY, to the file path FILE. Allowed flags for the command are: R : In case a registry key KEY is specified, exports the whole subtree rimp FILE = Imports the registry file FILE into the device registry. New keys will be created if missing, and existing values will be overwritten help = Prints this help screen %s Missing argoument Unable to open process: %s Unable to kill process: %s Invalid path: '%s' Path not found: '%s' %s\*%s*%s Path not found Out of memory Cannot enumerate devices %s Unable to get modules snapshot MID MCNT PCNT BASE SIZE FILE ???? 0x%-10lx%-6lu%-6lu0x%-10lx%-8lu%s Unable to get process snapshot PID = 0x%-10lxPPID = 0x%-10lxNTHR = %-6luPRIO = %-6ldFILE = '%s' Out of memory Cannot enumerate services PFIX STATUS FILE %-8s%-9ld%s TOTB = %lu bytes FREE = %lu bytes -pMissing argoument Invalid path: '%s' Unable to create directory: '%s' Missing argouments Invalid path: '%s' Invalid path: '%s' Unable to move file: '%s' -> '%s' Unable to get process snapshot PID PPID NTHR PRIO FILE 0x%-10lx0x%-10lx%-6lu%-6ld%s Missing argoument Invalid path: '%s' putfCannot create: '%s' Cannot create: '%s' Cannot write: '%s' %s Missing argoument Invalid path: '%s' Registry value path not found: '%s' %s Missing argoument Invalid path: '%s' Invalid path: '%s' %s\%s -iMissing argouments BISZDWInvalid data type: '%s' Invalid path: '%s' Invalid data format: '%s' Goodbye! (reboot) [%s] "%s"=%s "%s"=%s %s%s [%s] -RMissing argouments Invalid path: '%s' Invalid path: '%s' Registry path not found: '%s' wCannot create file: '%s' REGEDIT4 Registry export failed %s Missing argouments Invalid path: '%s' 0123456789abcdefABCDEFqwertyuioplkjhgfdsazxcvbnmQWERTYUIOPLKJHGFDSAZXCVBNM0123456789_ %2xMissing argoument Invalid path: '%s' rCannot open file: '%s' REGEDIT4 ]Unable to create key: '%s' ":dwordhexhex(7)hex(2)%xUnable to set value: '%s' Invalid registry file: '%s' %s Invalid path: '%s' Registry path not found: '%s' %s Missing argoument Invalid path: '%s' Unable to remove file: '%s' Missing argoument Invalid path: '%s' Unable to remove directory: '%s' Missing argoument Invalid path: '%s' Invalid path: '%s' Unable to create key: '%s' Key path already exists: '%s' Missing argoument Invalid path: '%s' Unable to remove tree: '%s' %s Missing argoument Invalid path: '%s' Invalid path: '%s' Unable to delete value: '%s' Missing argoument Invalid path: '%s' Invalid path: '%s' Unable to delete value: '%s' Missing argouments BISZDWInvalid data type: '%s' Invalid path: '%s' Invalid path: '%s' Invalid data format: '%s' Unable to set value: '%s' = '%s' CON0:CON0:CON0:Missing argouments Invalid path: '%s' runUnable to execute: '%s' Goodbye! (shutdown) Missing argouments -S-TInvalid action: '%s' Invalid argoument: '%s' Unable to control service: '%s' PID = 0x%-10lxPPID = 0x%-10lxNTHR = %-6luPRIO = %-6ldFILE = '%s' MID MCNT PCNT BASE SIZE FILE 0x%-10lx%-6lu%-6lu0x%-10lx%-8lu%s Unable to get modules snapshot Missing argoument Unable to get process snapshot \\%02xexitshutdownreboothelpcdpwdmkdirrmdirlsrmmvcpchmodrmtreefindputputfgetpslsmodwldkillrunexecdfmemlssvclsdevsvcrpwdrcdrlsrcatrfindrrmrrmtreermkkeyrsetrexprimprdig%ȃ(ԃd]܃/OXAH2}pD \&$J(J0*4hG88@D$0LhPhX#\@`>h6pt|hSxPh400]|kUSOFTWARE\WmConsole\Channel-P" Invalid command: '%s' WmConsole 0.18 server ready%s <%s> r\Program Files\WmConsole\passwd ,%2xBad login for user '%s' HKCRHKEY_CLASSES_ROOTHKCUHKEY_CURRENT_USERHKLMHKEY_LOCAL_MACHINEHKUSHKEY_USERS@Lt\%s%s%s%s%ld\\,%02xhex:dword:%08lx"%s""%s"%s:"%s"rsl:lnk:???:hex:dword:%08lx"%s"hex(2):hex(7):hex(?):\%s%s\%s%s\%s+%5s%6lu %sBINDWSZMSZXSZRSLLNK???%5s%6lu %sD5B 5 5 55 5 en j  55  % WMCONSOLERCX%s%ld:rconsole.dllRCX%s .%s ..\%s%s JanFebMarAprMayJunJulAugSepOctNovDec.exer-xr-xr-xrwxrwxrwxr--r--r--rw-rw-rw-d-%s %2d %02d:%02d %4d%s%s %7ld %s %s%s*%s\*%s%s%s\%s%s*%s\*%s%s%s\%sUnknown error (0x%lx) %s (0x%lx)OS error: %s %2xReportFaultcoredll.dllInitialization errorRSDSJEMvAz`c:\projects\wmconsole\wmconsole\wmconsole\PPC2003\Debug\wmconsole.pdbX`YxYdY20:XK!8Wm^B$-E?) },|X)^Wy[TU(~%YA;IJI={l*.*" ܎ҎĎhV<, Process32NextCloseToolhelp32Snapshot Process32FirstCreateToolhelp32SnapshotModule32NextModule32Firsttoolhelp.dll WSASetServiceW-closesocketClisten:getsockname,bindNsocketWSACleanup"WSAStartup+acceptFrecvIsendWS2.dllCOREDLL.dllXK!8Wm^B$-E?) },|X)^Wy[TU(~%YA;IJI={l*.*" ܎ҎĎhV<,QdO\@p4@@Z@@@@!!@h"W@#@%"@\&@)>@*/@/$@$0@H2&@6z@8@;@>@@-@XA@pD@hG@Jz@O%@P@hS@UE@[}@\@d]#@]@xd,@(eG@Df$@f!@Xg,@h5@h@k@|kr@Du@uN@v@x@|@}@@@@%@4@0@0N@h@{@̗c@X9@<;@("@@@ z@@PZ@@,2@%@@?@5@Ԫ@PH@p@@4K@`N@g@4i@ضC@a@S@]@T[@@0|@ @@@hP@Q@@ @@@P@P@_@$@^@@D'}@h)@,@T,@,@,/@-(@H.O@/@/A@0C@1@82@2U@3@44?@05;@6@8@(9@9@9@l:@='@H>@A@dC@C@HF@F@I`@J8@dK@K@,L$@L7@MC@N>@OD@Q @Q@R@R@R@R@R@ S5@X5xY @Y @YR@ [@`[@[@(\ @X\ @\@\5@h]@t]@]@v_]]